| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50303836 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_594921 (CHEMBL1041654) |
|---|
| Ki | >1000±n/a nM |
|---|
| Citation |  Lange, JH; Coolen, HK; van der Neut, MA; Borst, AJ; Stork, B; Verveer, PC; Kruse, CG Design, synthesis, biological properties, and molecular modeling investigations of novel tacrine derivatives with a combination of acetylcholinesterase inhibition and cannabinoid CB1 receptor antagonism. J Med Chem53:1338-46 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50303836 |
|---|
| n/a |
|---|
| Name | BDBM50303836 |
|---|
| Synonyms: | 3-(4-Chlorophenyl)-N'-((4-chlorophenyl)sulfonyl)-N-[4-(methyl)-piperidin-4-yl]-4-phenyl-4,5-dihydro-1H-pyrazole-1-carboxamidine | CHEMBL566388 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H29Cl2N5O2S |
|---|
| Mol. Mass. | 570.533 |
|---|
| SMILES | CN1CCC(CC1)N=C(NS(=O)(=O)c1ccc(Cl)cc1)N1CC(C(=N1)c1ccc(Cl)cc1)c1ccccc1 |w:7.7,c:25| |
|---|
| Structure | 
|
|---|
Search and Browse
