| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Ligand | BDBM50304138 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_602349 (CHEMBL1041579) |
|---|
| Ki | 2000±n/a nM |
|---|
| Citation |  Hocková, D; Holý, A; Masojídková, M; Keough, DT; de Jersey, J; Guddat, LW Synthesis of branched 9-[2-(2-phosphonoethoxy)ethyl]purines as a new class of acyclic nucleoside phosphonates which inhibit Plasmodium falciparum hypoxanthine-guanine-xanthine phosphoribosyltransferase. Bioorg Med Chem17:6218-32 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Name: | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24579.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00492 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
|---|
| BDBM50304138 |
|---|
| n/a |
|---|
| Name | BDBM50304138 |
|---|
| Synonyms: | 9-[2-(1-Phosphonopropan-2-yloxy)ethyl]hypoxanthine | CHEMBL596018 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H15N4O5P |
|---|
| Mol. Mass. | 302.2237 |
|---|
| SMILES | CC(CP(O)(O)=O)OCCn1cnc2c1nc[nH]c2=O |
|---|
| Structure | 
|
|---|
Search and Browse
