Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine Oxidase Type B (MAO-B)
LigandBDBM50304156
Substrate/Competitorn/a
Meas. Tech.ChEMBL_601026
Ki 1230±n/a nM
Citation Gökhan-Kelekçi NSimsek OOErcan AYelekçi KSahin ZSIsik SUçar GBilgin AA Synthesis and molecular modeling of some novel hexahydroindazole derivatives as potent monoamine oxidase inhibitors. Bioorg Med Chem 17:6761-72 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine Oxidase Type B (MAO-B)
Name:Monoamine oxidase
Synonyms:Amine oxidase (flavin-containing) B | Amine oxidase [flavin-containing] B | MAOB | Monoamine oxidase | Monoamine oxidase B (MAO-B) | Monoamine oxidase B (rMAO-B) | Monoamine oxidase type B (MAOB) | Monoamine oxidase-B (MAO-B)
Type:Enzyme
Mol. Mass.:58469.65
Organism:Rattus norvegicus (rat)
Description:P19643
Residue:520
Sequence:
MSNKCDVIVVGGGISGMAAAKLLHDCGLSVVVLEARDRVGGRTYTIRNKNVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHFVKGKSYAFRGPFPPVWNPITYLDYNNLWR
TMDEMGQEIPSDAPWKAPLAEEWDYMTMKELLDKICWTNSTKQIATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFIGGSGQVSERIKDILGDRVKLERPVIHIDQ
TGENVVVKTLNHEIYEAKYVISAIPPVLGMKIHHSPPLPILRNQLITRVPLGSVIKCMVY
YKEPFWRKKDFCGTMVIEGEEAPIAYTLDDTKPDGSCAAIMGFILAHKARKLVRLTKEER
LRKLCELYAKVLNSQEALQPVHYEEKNWCEEQYSGGCYTAYFPPGILTQYGRVLRQPVGK
IFFAGTETASHWSGYMEGAVEAGERAAREILHAIGKIPEDEIWQPEPESVDVPARPITNT
FLERHLPSVPGLLKLLGLTTILSATALGFLAHKKGLFVRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50304156
n/a
NameBDBM50304156
Synonyms:3-(2-Furyl)-2-(N-phenyllthiocarbamoyl)-3,3a,4,5,6,7-hexahydro-2H-indazol | CHEMBL594029
TypeSmall organic molecule
Emp. Form.C18H19N3OS
Mol. Mass.325.428
SMILESS=C(Nc1ccccc1)N1N=C2CCCCC2C1c1ccco1 |t:11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: