| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50304493 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_603842 (CHEMBL1046459) |
|---|
| IC50 | 45±n/a nM |
|---|
| Citation |  Yamamoto, T; Nair, P; Ma, SW; Davis, P; Yamamura, HI; Vanderah, TW; Porreca, F; Lai, J; Hruby, VJ The biological activity and metabolic stability of peptidic bifunctional compounds that are opioid receptor agonists and neurokinin-1 receptor antagonists with a cystine moiety. Bioorg Med Chem17:7337-43 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50304493 |
|---|
| n/a |
|---|
| Name | BDBM50304493 |
|---|
| Synonyms: | CHEMBL595972 | Tyr-D-Ala-Gly-Phe-Met-NH2 | Tyr-DAla-Gly-Phe-Met-NH2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H38N6O6S |
|---|
| Mol. Mass. | 586.703 |
|---|
| SMILES | CSCC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
