Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor Edg-4
LigandBDBM50271765
Substrate/Competitorn/a
Meas. Tech.ChEMBL_605120
IC50 9±n/a nM
Citation Fells JITsukahara RLiu JTigyi GParrill AL Structure-based drug design identifies novel LPA3 antagonists. Bioorg Med Chem 17:7457-64 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor Edg-4
Name:Lysophosphatidic acid receptor Edg-4
Synonyms:LPA receptor 2 | LPA-2 | Lysophosphatidic acid receptor 2
Type:PROTEIN
Mol. Mass.:39103.44
Organism:Homo sapiens (Human)
Description:ChEMBL_1451385
Residue:351
Sequence:
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50271765
n/a
NameBDBM50271765
Synonyms:3-(4-{3-[4-(3-Carboxy-acryloylamino)-phenoxy]-phenoxy}-phenylcarbamoyl)-acrylic acid | 4,4'-(4,4'-(1,3-phenylenebis(oxy))bis(4,1-phenylene))bis(azanediyl)bis(4-oxobut-2-enoic acid) | CHEMBL482498
TypeSmall organic molecule
Emp. Form.C26H20N2O8
Mol. Mass.488.4456
SMILESOC(=O)\C=C\C(=O)Nc1ccc(Oc2cccc(Oc3ccc(NC(=O)\C=C\C(O)=O)cc3)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: