Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVitamin D receptor
LigandBDBM50200182
Substrate/Competitorn/a
Meas. Tech.ChEMBL_606218
Ki 0.1±n/a nM
Citation Barycki RSicinski RRPlum LAGrzywacz PClagett-Dame MDeluca HF Removal of the 20-methyl group from 2-methylene-19-nor-(20S)-1alpha,25-dihydroxyvitamin D(3) (2MD) selectively eliminates bone calcium mobilization activity. Bioorg Med Chem 17:7658-69 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vitamin D receptor
Name:Vitamin D receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:47811.07
Organism:Rattus norvegicus
Description:ChEMBL_1505946
Residue:423
Sequence:
MEATAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMIMKRKEEEALKDSL
RPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSYSPRPTLSFSGNSSS
SSSDLYTTSLDMMEPSGFSNLDLNGEDSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGF
AKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAG
HTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQ
TYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN
EIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50200182
n/a
NameBDBM50200182
Synonyms:(1S,3R,5Z,7E)-9,10-secocholesta-5,7,10(19)-triene-1,3,25-triol | (1S,3R,5Z,7E)-9,10-secocholesta-5,7,10-triene-1,3,25-triol | (1alpha,3beta,5Z,7E)-9,10-secocholesta-5,7,10(19)-triene-1,3,25-triol | (5Z,7E)-(1S,3R)-9,10-secocholesta-5,7,10(19)-triene-1,3,25-triol | 1,25-DHCC | 1alpha,25(OH)2D3 | 1alpha,25-dihydroxycholecalciferol | 1alpha,25-dihydroxyvitamin D3 | CALCITRIOL | CHEMBL846
TypeSmall organic molecule
Emp. Form.C27H44O3
Mol. Mass.416.6365
SMILESC[C@H](CCCC(C)(C)O)[C@H]1CC[C@H]2\C(CCC[C@]12C)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: