Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVitamin D receptor
LigandBDBM50304584
Substrate/Competitorn/a
Meas. Tech.ChEMBL_606218
Ki 0.2±n/a nM
Citation Barycki RSicinski RRPlum LAGrzywacz PClagett-Dame MDeluca HF Removal of the 20-methyl group from 2-methylene-19-nor-(20S)-1alpha,25-dihydroxyvitamin D(3) (2MD) selectively eliminates bone calcium mobilization activity. Bioorg Med Chem 17:7658-69 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vitamin D receptor
Name:Vitamin D receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:47811.07
Organism:Rattus norvegicus
Description:ChEMBL_1505946
Residue:423
Sequence:
MEATAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMIMKRKEEEALKDSL
RPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSYSPRPTLSFSGNSSS
SSSDLYTTSLDMMEPSGFSNLDLNGEDSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGF
AKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAG
HTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQ
TYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN
EIS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50304584
n/a
NameBDBM50304584
Synonyms:1alpha,25-Dihydroxy-2-methylene-19,21-dinorvitamin D3 | CHEMBL607373
TypeSmall organic molecule
Emp. Form.C26H42O3
Mol. Mass.402.6099
SMILES[#6]C([#6])([#8])[#6]-[#6]-[#6]-[#6]-[#6@H]1-[#6]-[#6]-[#6@H]2\[#6](-[#6]-[#6]-[#6][C@]12[#6])=[#6]\[#6]=[#6]-1\[#6]-[#6@@H](-[#8])-[#6](=[#6])-[#6@H](-[#8])-[#6]-1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: