Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-activated protein kinase 2
LigandBDBM50305000
Substrate/Competitorn/a
Meas. Tech.ChEMBL_606910
IC50 160±n/a nM
Citation Harris CMEricsson AMArgiriadi MABarberis CBorhani DWBurchat ACalderwood DJCunha GADixon RWFrank KEJohnson EFKamens JKwak SLi BMullen KDPerron DCWang LWishart NWu XZhang XZmetra TRTalanian RV 2,4-Diaminopyrimidine MK2 inhibitors. Part II: Structure-based inhibitor optimization. Bioorg Med Chem Lett 20:334-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-activated protein kinase 2
Name:MAP kinase-activated protein kinase 2
Synonyms:MAP kinase-activated protein kinase 2 (MAPKAPK2) | MAP kinase-activated protein kinase 2 (MK2) | MAP kinase-activated protein kinase 2 (p38/MK2) | MAPK-Activated Protein Kinase 2 (MK2) | MAPK-activated protein kinase 2 | MAPKAP kinase 2 | MAPKAPK-2 | MAPKAPK2 | MK2
Type:Serine/threonine-protein kinase
Mol. Mass.:45579.87
Organism:Homo sapiens (Human)
Description:P49137
Residue:400
Sequence:
MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSAL
ATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50305000
n/a
NameBDBM50305000
Synonyms:CHEMBL600081 | N4-(3-(benzo[b]thiophen-2-yl)-1H-indazol-5-yl)pyrimidine-2,4-diamine
TypeSmall organic molecule
Emp. Form.C19H14N6S
Mol. Mass.358.42
SMILESNc1nccc(Nc2ccc3[nH]nc(-c4cc5ccccc5s4)c3c2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: