Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM kinase IV
LigandBDBM50305006
Substrate/Competitorn/a
Meas. Tech.ChEMBL_606963
IC50>10000±n/a nM
Citation Harris CMEricsson AMArgiriadi MABarberis CBorhani DWBurchat ACalderwood DJCunha GADixon RWFrank KEJohnson EFKamens JKwak SLi BMullen KDPerron DCWang LWishart NWu XZhang XZmetra TRTalanian RV 2,4-Diaminopyrimidine MK2 inhibitors. Part II: Structure-based inhibitor optimization. Bioorg Med Chem Lett 20:334-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CaM kinase IV
Name:CaM kinase IV
Synonyms:CAM kinase-GR | CAMK4 | CaMK IV | Calcium/calmodulin-dependent protein kinase type IV
Type:PROTEIN
Mol. Mass.:51919.87
Organism:Homo sapiens (Human)
Description:ChEMBL_1459854
Residue:473
Sequence:
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50305006
n/a
NameBDBM50305006
Synonyms:5-(2-aminoethyl)-7-(7-(benzo[b]thiophen-2-yl)-1H-indazol-5-yl)-5H-pyrrolo[3,2-d]pyrimidin-2-amine | CHEMBL590109
TypeSmall organic molecule
Emp. Form.C23H19N7S
Mol. Mass.425.509
SMILESNCCn1cc(-c2cc(-c3cc4ccccc4s3)c3[nH]ncc3c2)c2nc(N)ncc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: