Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP-binding cassette sub-family G member 2
LigandBDBM50206310
Substrate/Competitorn/a
Meas. Tech.ChEMBL_603046
IC50 430±n/a nM
Citation Pick AMüller HWiese M Novel lead for potent inhibitors of breast cancer resistance protein (BCRP). Bioorg Med Chem Lett 20:180-3 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ATP-binding cassette sub-family G member 2
Name:ATP-binding cassette sub-family G member 2
Synonyms:ABCP | ATP-Binding Cassette Transporter ABCG2 | ATP-binding cassette sub-family G member 2 | ATP-binding cassette transporter (ABCG2) | ATP-binding cassette, sub-family G, member 2 | BCRP | BCRP1 | Breast cancer resistance protein | CDw338 | MXR | Mitoxantrone resistance-associated protein | Placenta-specific ATP-binding cassette transporter | Urate exporter
Type:Multi-pass membrane protein; monomer or homodimer; disulfide-linked
Mol. Mass.:72329.48
Organism:Homo sapiens (Human)
Description:Q9UNQ0
Residue:655
Sequence:
MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN
NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50206310
n/a
NameBDBM50206310
Synonyms:5-Methoxy-9-oxo-9,10-dihydro-acridine-4-carboxylic acid {4-[2-(6,7-dimethoxy-3,4-dihydro-1H-isoquinolin-2-yl)-ethyl]-phenyl}-amide | CHEMBL396298 | ELACRIDAR HYDROCHLORIDE | Elacridar | N-(4-(2-(6,7-dimethoxy-3,4-dihydroisoquinolin-2(1H)-yl)ethyl)phenyl)-5-methoxy-9-oxo-9,10-dihydroacridine-2-carboxamide | N-(4-(2-(6,7-dimethoxy-3,4-dihydroisoquinolin-2(1H)-yl)ethyl)phenyl)-5-methoxy-9-oxo-9,10-dihydroacridine-4-carboxamide | N-4-[2-(1,2,3,4-Tetrahydro-6,7-dimethoxy-2-isoquinolinyl)ethyl]phenyl}-9,10-dihydro-5-methoxy-9-oxo-4-acridone carboxamide
TypeSmall organic molecule
Emp. Form.C34H33N3O5
Mol. Mass.563.6429
SMILESCOc1cc2CCN(CCc3ccc(NC(=O)c4cccc5c4[nH]c4c(OC)cccc4c5=O)cc3)Cc2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: