Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 3
LigandBDBM50305385
Substrate/Competitorn/a
Meas. Tech.ChEMBL_603591
EC50>10000±n/a nM
Citation Zécri FJAlbert RLandrum GHinterding KCooke NGGuerini DStreiff MBruns CNuesslein-Hildesheim B Pyrazole derived from (+)-3-carene; a novel potent, selective scaffold for sphingosine-1-phosphate (S1P(1)) receptor agonists. Bioorg Med Chem Lett 20:35-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 3
Name:Sphingosine 1-phosphate receptor Edg-5/Sphingosine 1-phosphate receptor Edg-3
Synonyms:EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42278.13
Organism:Homo sapiens (Human)
Description:Q99500
Residue:378
Sequence:
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50305385
n/a
NameBDBM50305385
Synonyms:3-Phenyl-1-((3bS,4aR)-3,4,4-trimethyl-3b,4,4a,5-tetrahydro-cyclopropa[3,4]cyclopenta[1,2-c]pyrazol-1-yl)-propan-1-one | CHEMBL596052
TypeSmall organic molecule
Emp. Form.C19H22N2O
Mol. Mass.294.3908
SMILESCc1nn(C(=O)CCc2ccccc2)c2C[C@@H]3[C@H](c12)C3(C)C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: