Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-Phosphate Receptor 4
LigandBDBM50305386
Substrate/Competitorn/a
Meas. Tech.ChEMBL_603593
EC50>10000±n/a nM
Citation Zécri FJAlbert RLandrum GHinterding KCooke NGGuerini DStreiff MBruns CNuesslein-Hildesheim B Pyrazole derived from (+)-3-carene; a novel potent, selective scaffold for sphingosine-1-phosphate (S1P(1)) receptor agonists. Bioorg Med Chem Lett 20:35-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-Phosphate Receptor 4
Name:Sphingosine 1-phosphate receptor
Synonyms:EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41647.39
Organism:Homo sapiens (Human)
Description:n/a
Residue:384
Sequence:
MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50305386
n/a
NameBDBM50305386
Synonyms:1-((3bS,4aR)-3,4,4-Trimethyl-3b,4,4a,5-tetrahydro-cyclopropa[3,4]cyclopenta[1,2-c]pyrazol-1-yl)-heptan-1-one | CHEMBL596053
TypeSmall organic molecule
Emp. Form.C17H26N2O
Mol. Mass.274.4011
SMILESCCCCCCC(=O)n1nc(C)c2[C@H]3[C@@H](Cc12)C3(C)C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: