Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxytocin receptor
LigandBDBM50305514
Substrate/Competitorn/a
Meas. Tech.ChEMBL_604218
Ki 35.9±n/a nM
Citation Brown ABrown TBCalabrese AEllis DPuhalo NRalph MWatson L Triazole oxytocin antagonists: Identification of an aryloxyazetidine replacement for a biaryl substituent. Bioorg Med Chem Lett 20:516-20 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oxytocin receptor
Name:Oxytocin receptor
Synonyms:OT-R | Oxytocin
Type:Enzyme Catalytic Domain
Mol. Mass.:42793.26
Organism:HEK293
Description:Oxytocin OXTR HEK293::B2R9L7
Residue:389
Sequence:
MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACV
LLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGET
SASKKSNSSSFVLSHRSSSQRSCSQPSTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50305514
n/a
NameBDBM50305514
Synonyms:(R)-2-methoxy-5-(3-methyl-5-(3-(o-tolyloxy)pyrrolidin-1-yl)-4H-1,2,4-triazol-4-yl)pyridine | CHEMBL592731
TypeSmall organic molecule
Emp. Form.C20H23N5O2
Mol. Mass.365.4289
SMILESCOc1ccc(cn1)-n1c(C)nnc1N1CC[C@H](C1)Oc1ccccc1C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: