Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Ligand | BDBM50305680 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_604567 (CHEMBL1065476) |
---|
IC50 | 260±n/a nM |
---|
Citation | Potter, AJ; Ray, S; Gueritz, L; Nunns, CL; Bryant, CJ; Scrace, SF; Matassova, N; Baker, L; Dokurno, P; Robinson, DA; Surgenor, AE; Davis, B; Murray, JB; Richardson, CM; Moore, JD Structure-guided design of alpha-amino acid-derived Pin1 inhibitors. Bioorg Med Chem Lett20:586-90 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Type: | PROTEIN |
Mol. Mass.: | 18248.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1502595 |
Residue: | 163 |
Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
BDBM50305680 |
---|
n/a |
---|
Name | BDBM50305680 |
Synonyms: | (R)-methyl 3-(1H-benzo[d]imidazol-2-yl)-2-(1-methyl-3-phenyl-1H-pyrazole-5-carboxamido)propanoate | CHEMBL594125 |
Type | Small organic molecule |
Emp. Form. | C22H21N5O3 |
Mol. Mass. | 403.4338 |
SMILES | COC(=O)[C@@H](Cc1nc2ccccc2[nH]1)NC(=O)c1cc(nn1C)-c1ccccc1 |r| |
Structure |
|