Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-24
LigandBDBM50305842
Substrate/Competitorn/a
Meas. Tech.ChEMBL_605236
Ki>25000±n/a nM
Citation Schnute MEO'Brien PMNahra JMorris MHoward Roark WHanau CERuminski PGScholten JAFletcher TRHamper BCCarroll JNPatt WCShieh HSCollins BPavlovsky AGPalmquist KEAston KWHitchcock JRogers MDMcDonald JJohnson ARMunie GEWittwer AJMan CFSettle SLNemirovskiy OVickery LEAgawal ADyer RDSunyer T Discovery of (pyridin-4-yl)-2H-tetrazole as a novel scaffold to identify highly selective matrix metalloproteinase-13 inhibitors for the treatment of osteoarthritis. Bioorg Med Chem Lett 20:576-80 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-24
Name:Matrix metalloproteinase-24
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:73256.27
Organism:Homo sapiens (Human)
Description:ChEMBL_806651
Residue:645
Sequence:
MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALCCLPGAARAAAAAAGAG
NRAAVAVAVARADEAEAPFAGQNWLKSYGYLLPYDSRASALHSAKALQSAVSTMQQFYGI
PVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKVG
ELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGG
FLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIM
APFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQPR
PPRPPLGDRPSTPGTKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQ
FWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGIDTAL
RWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTYFYK
GRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEVERRKERRLPQDDVDIMVTINDVPGSV
NAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50305842
n/a
NameBDBM50305842
Synonyms:CHEMBL603656 | trans-4-((5-(2-(4-fluorobenzylcarbamoyl)-6-methylpyridin-4-yl)-2H-tetrazol-2-yl)methyl)cyclohexanecarboxylic acid
TypeSmall organic molecule
Emp. Form.C23H25FN6O3
Mol. Mass.452.4814
SMILESCc1cc(cc(n1)C(=O)NCc1ccc(F)cc1)-c1nnn(C[C@H]2CC[C@@H](CC2)C(O)=O)n1 |r,wU:26.31,wD:23.24,(30.11,-12.24,;29.32,-10.92,;30.07,-9.57,;29.28,-8.26,;27.74,-8.27,;26.98,-9.62,;27.77,-10.94,;25.44,-9.64,;24.69,-10.98,;24.66,-8.31,;23.12,-8.33,;22.33,-7.01,;23.08,-5.67,;22.3,-4.34,;20.75,-4.36,;19.97,-3.04,;20,-5.72,;20.79,-7.03,;30.03,-6.91,;29.39,-5.51,;30.52,-4.46,;31.87,-5.21,;33.27,-4.57,;34.61,-5.32,;34.63,-6.85,;35.98,-7.6,;37.3,-6.81,;37.27,-5.26,;35.93,-4.52,;38.65,-7.56,;38.68,-9.1,;39.97,-6.77,;31.57,-6.73,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: