Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 7 (mGlu7)
LigandBDBM50305868
Substrate/Competitorn/a
Meas. Tech.ChEMBL_605281
IC50 51±n/a nM
Citation Nakamura MKurihara HSuzuki GMitsuya MOhkubo MOhta H Isoxazolopyridone derivatives as allosteric metabotropic glutamate receptor 7 antagonists. Bioorg Med Chem Lett 20:726-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 7 (mGlu7)
Name:Metabotropic glutamate receptor 7 (mGlu7)
Synonyms:Metabotropic glutamate receptor | mGlu7
Type:Enzyme
Mol. Mass.:102244.48
Organism:Rattus norvegicus (Rat)
Description:P35400
Residue:915
Sequence:
MVQLGKLLRVLTLMKFPCCVLEVLLCVLAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
TFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
ISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRR
NVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH
ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRHVNFNGSAGTPVMFNKNGDAPGRYDIF
QYQTTNTTNPGYRLIGQWTDELQLNIEDMQWGKGVREIPSSVCTLPCKPGQRKKTQKGTP
CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQNIPIIKLEWHSPWAVIPVFLAML
GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
FGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
PAAKKKYVSYNNLVI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50305868
n/a
NameBDBM50305868
Synonyms:5-methyl-3-phenyl-6-p-tolylisoxazolo[4,5-c]pyridin-4(5H)-one | CHEMBL595825
TypeSmall organic molecule
Emp. Form.C20H16N2O2
Mol. Mass.316.3532
SMILESCc1ccc(cc1)-c1cc2onc(-c3ccccc3)c2c(=O)n1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: