| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50197834 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_609003 (CHEMBL1073145) |
|---|
| IC50 | 214±n/a nM |
|---|
| Citation |  Hegde, VR; Borges, S; Patel, M; Das, PR; Wu, B; Gullo, VP; Chan, TM New potential antitumor compounds from the plant Aristolochia manshuriensis as inhibitors of the CDK2 enzyme. Bioorg Med Chem Lett20:1344-6 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50197834 |
|---|
| n/a |
|---|
| Name | BDBM50197834 |
|---|
| Synonyms: | 2,9-dihydroxy-1-methoxydibenzo[cd,f]indol-4(5H)-one | CHEMBL388956 | SCH-546909 | aristolactam AIIIa | aristololactam A IIIa |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H11NO4 |
|---|
| Mol. Mass. | 281.2628 |
|---|
| SMILES | COc1c(O)cc2C(=O)Nc3cc4ccc(O)cc4c1c23 |
|---|
| Structure | 
|
|---|
Search and Browse
