Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnandamide amidohydrolase
LigandBDBM50307060
Substrate/Competitorn/a
Meas. Tech.ChEMBL_609358
IC50 1040±n/a nM
Citation Long JZJin XAdibekian ALi WCravatt BF Characterization of tunable piperidine and piperazine carbamates as inhibitors of endocannabinoid hydrolases. J Med Chem 53:1830-42 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Anandamide amidohydrolase
Name:Anandamide amidohydrolase
Synonyms:Anandamide amidohydrolase 1 | Fatty Acid Amide Hydrolase | Fatty-acid amide hydrolase (FAAH) | Fatty-acid amide hydrolase 1 | Oleamide hydrolase 1
Type:Hydrolase; single-pass membrane protein; homodimer
Mol. Mass.:63227.28
Organism:Mus musculus (mouse)
Description:Mouse brain membranes were used in the assay.
Residue:579
Sequence:
MVLSEVWTALSGLSGVCLACSLLSAAVVLRWTRSQTARGAVTRARQKQRAGLETMDKAVQ
RFRLQNPDLDSEALLALPLLQLVQKLQSGELSPEAVLFTYLGKAWEVNKGTNCVTSYLTD
CETQLSQAPRQGLLYGVPVSLKECFSYKGHASTLGLSLNEGVTSESDCVVVQVLKLQGAV
PFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSAFCGICGLKPTGNRLSKSGLKSCVYGQTAVQLSVGPMARDVDSLALCMKALLCE
DLFRLDSTIPPLPFREEIYRSSRPLRVGYYETDNYTMPTPAMRRAVMETKQSLEAAGHTL
VPFLPNNIPYALEVLSAGGLFSDGGCSFLQNFKGDFVDPCLGDLVLVLKLPRWFKKLLSF
LLKPLFPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSVIAQWKAMNLDVVLTPMLGPALD
LNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMEHYKGYFGDMWDNILKKGMK
KGIGLPVAVQCVALPWQEELCLRFMREVERLMTPEKRPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50307060
n/a
NameBDBM50307060
Synonyms:4-Nitrophenyl 4-(Quinolin-2-ylmethyl)piperazine-1-carboxylate | CHEMBL597699
TypeSmall organic molecule
Emp. Form.C21H20N4O4
Mol. Mass.392.4079
SMILES[O-][N+](=O)c1ccc(OC(=O)N2CCN(Cc3ccc4ccccc4n3)CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: