Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP3 subtype |
---|
Ligand | BDBM50307434 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_610979 (CHEMBL1070310) |
---|
Ki | 0.1±n/a nM |
---|
Citation | Asada, M; Iwahashi, M; Obitsu, T; Kinoshita, A; Nakai, Y; Onoda, T; Nagase, T; Tanaka, M; Yamaura, Y; Takizawa, H; Yoshikawa, K; Sato, K; Narita, M; Ohuchida, S; Nakai, H; Toda, M 3-(2-Aminocarbonylphenyl)propanoic acid analogs as potent and selective EP3 receptor antagonists. part 2: optimization of the side chains to improve in vitro and in vivo potencies. Bioorg Med Chem18:1641-58 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP3 subtype |
---|
Name: | Prostaglandin E2 receptor EP3 subtype |
Synonyms: | PE2R3_MOUSE | PGE receptor, EP3 isoform alpha | Prostaglandin E2 receptor EP3 isoform alpha | Prostaglandin E3 | Prostanoid EP3 receptor | Ptger3 | Ptgerep3 |
Type: | G-protein coupled receptor |
Mol. Mass.: | 40092.50 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 365 |
Sequence: | MASMWAPEHSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDPAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AVSQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSALMWS
DQLER
|
|
|
BDBM50307434 |
---|
n/a |
---|
Name | BDBM50307434 |
Synonyms: | 3-{2-({[1-(3,5-Dimethylphenyl)-3-methylbutyl]amino}-carbonyl)-4-[(2-fluorophenoxy)methyl]phenyl}propanoic acid | CHEMBL603881 |
Type | Small organic molecule |
Emp. Form. | C30H34FNO4 |
Mol. Mass. | 491.5937 |
SMILES | CC(C)CC(NC(=O)c1cc(COc2ccccc2F)ccc1CCC(O)=O)c1cc(C)cc(C)c1 |
Structure |
|