| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP3 subtype |
|---|
| Ligand | BDBM50307443 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_610979 (CHEMBL1070310) |
|---|
| Ki | 0.27±n/a nM |
|---|
| Citation |  Asada, M; Iwahashi, M; Obitsu, T; Kinoshita, A; Nakai, Y; Onoda, T; Nagase, T; Tanaka, M; Yamaura, Y; Takizawa, H; Yoshikawa, K; Sato, K; Narita, M; Ohuchida, S; Nakai, H; Toda, M 3-(2-Aminocarbonylphenyl)propanoic acid analogs as potent and selective EP3 receptor antagonists. part 2: optimization of the side chains to improve in vitro and in vivo potencies. Bioorg Med Chem18:1641-58 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP3 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP3 subtype |
|---|
| Synonyms: | PE2R3_MOUSE | PGE receptor, EP3 isoform alpha | Prostaglandin E2 receptor EP3 isoform alpha | Prostaglandin E3 | Prostanoid EP3 receptor | Ptger3 | Ptgerep3 |
|---|
| Type: | G-protein coupled receptor |
|---|
| Mol. Mass.: | 40092.50 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 365 |
|---|
| Sequence: | MASMWAPEHSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDPAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AVSQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSALMWS
DQLER
|
|
|
|---|
| BDBM50307443 |
|---|
| n/a |
|---|
| Name | BDBM50307443 |
|---|
| Synonyms: | 3-{2-({[1-(3,5-Dimethylphenyl)-3-methylbutyl]amino}-carbonyl)-4-[(3-methoxyphenoxy)methyl]phenyl}propanoic acid | CHEMBL599405 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H37NO5 |
|---|
| Mol. Mass. | 503.6292 |
|---|
| SMILES | COc1cccc(OCc2ccc(CCC(O)=O)c(c2)C(=O)NC(CC(C)C)c2cc(C)cc(C)c2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
