Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-Dependent Kinase 5 (CDK5)
LigandBDBM50307507
Substrate/Competitorn/a
Meas. Tech.ChEMBL_611976
IC50 6±n/a nM
Citation Traquandi GCiomei MBallinari DCasale EColombo NCroci VFiorentini FIsacchi ALongo AMercurio CPanzeri APastori WPevarello PVolpi DRoussel PVulpetti ABrasca MG Identification of potent pyrazolo[4,3-h]quinazoline-3-carboxamides as multi-cyclin-dependent kinase inhibitors. J Med Chem 53:2171-87 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-Dependent Kinase 5 (CDK5)
Name:Cyclin-Dependent Kinase 5 (CDK5)
Synonyms:CDK5/p35 | Cyclin-dependent kinase 5 regulatory subunit 1 | Cyclin-dependent kinase 5/CDK5 activator 1
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Cyclin-T1/Cyclin-dependent-like kinase 5
Synonyms:CDK5 | Cyclin-dependent kinase 5 (CDK5/ p25) | Cyclin-dependent kinase 5 (CDK5/p35) | Cyclin-dependent-like kinase 5 (CDK5)
Type:Enzyme Subunit
Mol. Mass.:33308.61
Organism:Homo sapiens (Human)
Description:n/a
Residue:292
Sequence:
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Cyclin-dependent kinase 5 regulatory subunit 1
Synonyms:Cyclin-Dependent Kinase 5 Activator 1, p35 | Cyclin-dependent kinase 5 (CDK5/p25) | TPKII regulatory subunit | p35
Type:Enzyme Subunit
Mol. Mass.:34077.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:307
Sequence:
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
GSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50307507
n/a
NameBDBM50307507
Synonyms:CHEMBL597754 | N-1-Dimethyl-8-{[1-(methylsulfonyl)piperidin-4-yl]amino}-4,5-dihydro-1H-pyrazolo[4,3-h]quinazoline-3-carboxamide
TypeSmall organic molecule
Emp. Form.C24H34N8O4S
Mol. Mass.530.643
SMILESCNC(=O)c1nn(C)c-2c1CCc1cnc(NC3CCN(CC3)C(=O)C3CCN(CC3)S(C)(=O)=O)nc-21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: