Reaction Details |
| Report a problem with these data |
Target | P2Y purinoceptor 12 |
---|
Ligand | BDBM50307010 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_612285 (CHEMBL1064897) |
---|
Ki | 1.5±n/a nM |
---|
Citation | Parlow, JJ; Burney, MW; Case, BL; Girard, TJ; Hall, KA; Harris, PK; Hiebsch, RR; Huff, RM; Lachance, RM; Mischke, DA; Rapp, SR; Woerndle, RS; Ennis, MD Piperazinyl glutamate pyridines as potent orally bioavailable P2Y12 antagonists for inhibition of platelet aggregation. J Med Chem53:2010-37 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
P2Y purinoceptor 12 |
---|
Name: | P2Y purinoceptor 12 |
Synonyms: | ADP-glucose receptor | ADPG-R | HORK3 | P2RY12 | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | P2Y12_HUMAN | Purinergic receptor P2Y12 | SP1999 |
Type: | Enzyme |
Mol. Mass.: | 39458.48 |
Organism: | Homo sapiens (Human) |
Description: | Q9H244 |
Residue: | 342 |
Sequence: | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|
|
BDBM50307010 |
---|
n/a |
---|
Name | BDBM50307010 |
Synonyms: | (4S)4-{[(4-{4-[(Methylamino)ethyl]piperidin-1-yl}-6-phenylpyridin-2-yl)carbonyl]amino}-5-oxo-5-{4-[(pentyloxy)carbonyl]-piperazin-1-yl}pentanoic Acid | (S)-4-(4-(4-((methylamino)methyl)piperidin-1-yl)-6-phenylpicolinamido)-5-oxo-5-(4-(pentyloxycarbonyl)piperazin-1-yl)pentanoic acid | CHEMBL589519 |
Type | Small organic molecule |
Emp. Form. | C34H48N6O6 |
Mol. Mass. | 636.7815 |
SMILES | CCCCCOC(=O)N1CCN(CC1)C(=O)[C@H](CCC(O)=O)NC(=O)c1cc(cc(n1)-c1ccccc1)N1CCC(CNC)CC1 |r| |
Structure |
|