| Reaction Details |
|---|
 | Report a problem with these data |
| Target | P2Y purinoceptor 12 |
|---|
| Ligand | BDBM50307672 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_612285 (CHEMBL1064897) |
|---|
| Ki | 3.3±n/a nM |
|---|
| Citation |  Parlow, JJ; Burney, MW; Case, BL; Girard, TJ; Hall, KA; Harris, PK; Hiebsch, RR; Huff, RM; Lachance, RM; Mischke, DA; Rapp, SR; Woerndle, RS; Ennis, MD Piperazinyl glutamate pyridines as potent orally bioavailable P2Y12 antagonists for inhibition of platelet aggregation. J Med Chem53:2010-37 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| P2Y purinoceptor 12 |
|---|
| Name: | P2Y purinoceptor 12 |
|---|
| Synonyms: | ADP-glucose receptor | ADPG-R | HORK3 | P2RY12 | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | P2Y12_HUMAN | Purinergic receptor P2Y12 | SP1999 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39458.48 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9H244 |
|---|
| Residue: | 342 |
|---|
| Sequence: | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|
|
|---|
| BDBM50307672 |
|---|
| n/a |
|---|
| Name | BDBM50307672 |
|---|
| Synonyms: | (4S)-4-[({4-[4-(Dimethylamino)butyl]-6-phenylpyridin-2-yl}carbonyl)amino]-5-oxo-5-{4-[(pentyloxy)carbonyl]piperazin-1-yl}pentanoic Acid | CHEMBL591227 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H47N5O6 |
|---|
| Mol. Mass. | 609.7562 |
|---|
| SMILES | CCCCCOC(=O)N1CCN(CC1)C(=O)[C@H](CCC(O)=O)NC(=O)c1cc(CCCCN(C)C)cc(n1)-c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
