Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase AKT2
LigandBDBM50307959
Substrate/Competitorn/a
Meas. Tech.ChEMBL_608104
IC50 5.5±n/a nM
Citation McHardy TCaldwell JJCheung KMHunter LJTaylor KRowlands MRuddle RHenley Ade Haven Brandon AValenti MDavies TGFazal LSeavers LRaynaud FIEccles SAAherne GWGarrett MDCollins I Discovery of 4-amino-1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)piperidine-4-carboxamides as selective, orally active inhibitors of protein kinase B (Akt). J Med Chem 53:2239-49 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase AKT2
Name:Serine/threonine-protein kinase AKT2
Synonyms:AKT2 | PKB beta | Protein kinase Akt-2 | Protein kinase B (Akt 2) | Protein kinase B beta (AKT2) | Protein kinase B, beta | RAC-PK-beta | RAC-alpha serine/threonine-protein kinase (AKT2) | RAC-beta serine/threonine-protein kinase | RAC-beta serine/threonine-protein kinase (AKT2) | Serine/threonine-protein kinase AKT
Type:Enzyme
Mol. Mass.:55766.64
Organism:Homo sapiens (Human)
Description:n/a
Residue:481
Sequence:
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50307959
n/a
NameBDBM50307959
Synonyms:4-(4-Chlorobenzyl)-1-(1H-pyrrolo[2,3-b]pyridin-4-yl)piperidin-4-amine | CHEMBL596991 | US8796293, 54
TypeSmall organic molecule
Emp. Form.C19H21ClN4
Mol. Mass.340.85
SMILESNC1(Cc2ccc(Cl)cc2)CCN(CC1)c1ccnc2[nH]ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: