Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid EP4 receptor
LigandBDBM50308131
Substrate/Competitorn/a
Meas. Tech.ChEMBL_610074
Ki 0.700000±n/a nM
Citation Blouin MHan YBurch JFarand JMellon CGaudreault MWrona MLévesque JFDenis DMathieu MCStocco RVigneault ETherien AClark PRowland SXu DO'Neill GDucharme YFriesen R The discovery of 4-{1-[({2,5-dimethyl-4-[4-(trifluoromethyl)benzyl]-3-thienyl}carbonyl)amino]cyclopropyl}benzoic acid (MK-2894), a potent and selective prostaglandin E2 subtype 4 receptor antagonist. J Med Chem 53:2227-38 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid EP4 receptor
Name:Prostanoid EP4 receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53381.95
Organism:Rattus norvegicus
Description:ChEMBL_1290039
Residue:488
Sequence:
MSIPGVNASFSSTPERLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGDQALCDYSTFILLFFGLSGLSIICAMSIERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGRSERQYPGTWCFIDWTTNVTA
YAAFSYMYAGFSSFLILATVLCNVLVCGALLRMLRQFMRRTSLGTEQHHAAAAAAVASVA
CRGHAAASPALQRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFINQL
YQPSVVKDISRNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSGRD
GSAQHCSESRRTSSAMSGHSRSFLSRELREISSTSHTLLYLPDLTESSLGGKNLLPGTHG
MGLTQADTTSLRTLRISETSDSSQGQDSESVLLVDEVSGSQREEPASKGNSLQVTFPSET
LKLSEKCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50308131
n/a
NameBDBM50308131
Synonyms:4-{1-[({2,5-Dimethyl-4-[4-(trifluoromethyl)benzyl]-3-thienyl}-carbonyl)amino]cyclopropyl}benzoic Acid | CHEMBL597997
TypeSmall organic molecule
Emp. Form.C25H22F3NO3S
Mol. Mass.473.507
SMILESCc1sc(C)c(C(=O)NC2(CC2)c2ccc(cc2)C(O)=O)c1Cc1ccc(cc1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: