Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C
LigandBDBM50308557
Substrate/Competitorn/a
Meas. Tech.ChEMBL_613562
IC50>2000±n/a nM
Citation Hughes RORogier DJJacobsen EJWalker JKMacinnes ABond BRZhang LLYu YZheng YRumsey JMWalgren JLCurtiss SWFobian YMHeasley SECubbage JWMoon JBBrown DLAcker BAMaddux TMTollefson MBMischke BVOwen DRFreskos JNMolyneaux JMBenson AGBlevis-Bal RM Design, synthesis, and biological evaluation of 3-[4-(2-hydroxyethyl)piperazin-1-yl]-7-(6-methoxypyridin-3-yl)-1-(2-propoxyethyl)pyrido[3,4-b]pyrazin-2(1H)-one, a potent, orally active, brain penetrant inhibitor of phosphodiesterase 5 (PDE5). J Med Chem 53:2656-60 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4C
Name:Phosphodiesterase 4 and 5 (PDE4 and PDE5)
Synonyms:DPDE1 | PDE21 | PDE4C2 | Phosphodiesterase 4C
Type:PROTEIN
Mol. Mass.:79875.54
Organism:Homo sapiens (Human)
Description:ChEMBL_864910
Residue:712
Sequence:
MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERD
LSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESF
LYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGA
AKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRI
LNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSA
SLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLL
KTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILA
ALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNL
SAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQN
LVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGF
IDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYQSKIPRSPSDLTNPERDGPDRFQFEL
TLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50308557
n/a
NameBDBM50308557
Synonyms:3-(4-(2-hydroxyethyl)piperazin-1-yl)-1-(2-propoxyethyl)-7-(6-methoxypyridin-3-yl)pyrido[3,4-b]pyrazin-2(1H)-one | CHEMBL591501
TypeSmall organic molecule
Emp. Form.C24H32N6O4
Mol. Mass.468.5487
SMILESCCCOCCn1c2cc(ncc2nc(N2CCN(CCO)CC2)c1=O)-c1ccc(OC)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: