| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP3 subtype |
|---|
| Ligand | BDBM50308906 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_611726 (CHEMBL1074320) |
|---|
| Ki | 0.22±n/a nM |
|---|
| Citation |  Asada, M; Obitsu, T; Nagase, T; Tanaka, M; Yamaura, Y; Takizawa, H; Yoshikawa, K; Sato, K; Narita, M; Ohuchida, S; Nakai, H; Toda, M 3-(2-Aminocarbonylphenyl)propanoic acid analogs as potent and selective EP3 receptor antagonists. Part 1: discovery and exploration of the carboxyamide side chain. Bioorg Med Chem18:80-90 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP3 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP3 subtype |
|---|
| Synonyms: | PE2R3_MOUSE | PGE receptor, EP3 isoform alpha | Prostaglandin E2 receptor EP3 isoform alpha | Prostaglandin E3 | Prostanoid EP3 receptor | Ptger3 | Ptgerep3 |
|---|
| Type: | G-protein coupled receptor |
|---|
| Mol. Mass.: | 40092.50 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 365 |
|---|
| Sequence: | MASMWAPEHSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDPAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AVSQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSALMWS
DQLER
|
|
|
|---|
| BDBM50308906 |
|---|
| n/a |
|---|
| Name | BDBM50308906 |
|---|
| Synonyms: | 3-[2-({[(1R)-1-(1-Naphthyl)ethyl]amino}carbonyl)-4-(phenoxymethyl)phenyl]propanoic acid | CHEMBL599154 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H27NO4 |
|---|
| Mol. Mass. | 453.529 |
|---|
| SMILES | C[C@@H](NC(=O)c1cc(COc2ccccc2)ccc1CCC(O)=O)c1cccc2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
