Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium-dependent dopamine transporter
LigandBDBM50309514
Substrate/Competitorn/a
Meas. Tech.ChEMBL_609534
Ki>6140±n/a nM
Citation Dounay ABBarta NSCampbell BMColeman CCollantes EMDenny LDutta SGray DLHou DIyer RMaiti SNOrtwine DFProbert AStratman NCSubedi RWhisman TXu WZoski K Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agonists. Bioorg Med Chem Lett 20:1114-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium-dependent dopamine transporter
Name:Sodium-dependent dopamine transporter
Synonyms:DA transporter | DAT | DAT1 | Dopamine transporter (DAT) | Dopamine transporter protein (DAT) | SLC6A3 | Sodium-dependent dopamine transporter (DAT) | Solute carrier family 6 member 3
Type:Multi-pass membrane protein
Mol. Mass.:68497.11
Organism:Homo sapiens (Human)
Description:Q01959
Residue:620
Sequence:
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50309514
n/a
NameBDBM50309514
Synonyms:2-(2-fluoro-4-methylphenoxy)-3-(piperidin-4-yl)pyridine | CHEMBL599371
TypeSmall organic molecule
Emp. Form.C17H19FN2O
Mol. Mass.286.344
SMILESCc1ccc(Oc2ncccc2C2CCNCC2)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: