| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 3A |
|---|
| Ligand | BDBM50309866 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_611799 (CHEMBL1066456) |
|---|
| Ki | 3.4±n/a nM |
|---|
| Citation |  O'Donnell, CJ; Rogers, BN; Bronk, BS; Bryce, DK; Coe, JW; Cook, KK; Duplantier, AJ; Evrard, E; Hajós, M; Hoffmann, WE; Hurst, RS; Maklad, N; Mather, RJ; McLean, S; Nedza, FM; O'Neill, BT; Peng, L; Qian, W; Rottas, MM; Sands, SB; Schmidt, AW; Shrikhande, AV; Spracklin, DK; Wong, DF; Zhang, A; Zhang, L Discovery of 4-(5-methyloxazolo[4,5-b]pyridin-2-yl)-1,4-diazabicyclo[3.2.2]nonane (CP-810,123), a novel alpha 7 nicotinic acetylcholine receptor agonist for the treatment of cognitive disorders in schizophrenia: synthesis, SAR development, and in vivo efficacy in cognition models. J Med Chem53:1222-37 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 3A |
|---|
| Name: | 5-hydroxytryptamine receptor 3A |
|---|
| Synonyms: | 5-HT-3 | 5-HT3-A | 5-HT3A | 5-HT3A Serotonin Receptor | 5-HT3R | 5-hydroxytryptamine receptor 3 | 5-hydroxytryptamine receptor 3A | 5HT3A_MOUSE | 5ht3 | Htr3 | Htr3a | Serotonin 3 receptor (5HT3) | Serotonin 3a (5-HT3a) receptor | Serotonin receptor 3A | Serotonin-gated ion channel receptor |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 56056.00 |
|---|
| Organism: | Mus musculus (house mouse) |
|---|
| Description: | 5HT3A |
|---|
| Residue: | 487 |
|---|
| Sequence: | MRLCIPQVLLALFLSMLTAPGEGSRRRATQEDTTQPALLRLSDHLLANYKKGVRPVRDWR
KPTTVSIDVIMYAILNVDEKNQVLTTYIWYRQYWTDEFLQWTPEDFDNVTKLSIPTDSIW
VPDILINEFVDVGKSPNIPYVYVHHRGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTFT
SWLHTIQDINITLWRSPEEVRSDKSIFINQGEWELLEVFPQFKEFSIDISNSYAEMKFYV
IIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTLP
ATIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQRPVPDWLRHLVLDRIAWILCL
GEQPMAHRPPATFQANKTDDCSGSDLLPAMGNHCSHVGGPQDLEKTPRGRGSPLPPPREA
SLAVRGLLQELSSIRHFLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTL
WSIWHYS
|
|
|
|---|
| BDBM50309866 |
|---|
| n/a |
|---|
| Name | BDBM50309866 |
|---|
| Synonyms: | 4-(5-Methylbenzoxazol-2-yl)-1,4-diazabicyclo[3.2.2]nonane | CHEMBL597842 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H19N3O |
|---|
| Mol. Mass. | 257.3309 |
|---|
| SMILES | Cc1ccc2oc(nc2c1)N1CCN2CCC1CC2 |TLB:6:10:15.14:17.18,(11.7,-3.08,;10.17,-3.31,;9.19,-2.1,;7.67,-2.34,;7.11,-3.78,;5.67,-4.33,;5.73,-5.86,;7.23,-6.27,;8.08,-4.99,;9.61,-4.76,;4.4,-6.63,;4.77,-8.1,;3.76,-7.38,;2.39,-7.45,;2.31,-5.74,;2.93,-4.6,;2.99,-6.01,;1.7,-6.71,;1.4,-8.15,)| |
|---|
| Structure | 
|
|---|
Search and Browse
