Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase (P70S6K)
LigandBDBM50310456
Substrate/Competitorn/a
Meas. Tech.ChEMBL_619398
Ki 4±n/a nM
Citation Bandarage UHare BParsons JPham LMarhefka CBemis GTang QMoody CSRodems SShah SAdams CBravo JCharonnet ESavic VCome JHGreen J 4-(Benzimidazol-2-yl)-1,2,5-oxadiazol-3-ylamine derivatives: potent and selective p70S6 kinase inhibitors. Bioorg Med Chem Lett 19:5191-4 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ribosomal protein S6 kinase (P70S6K)
Name:Ribosomal protein S6 kinase (P70S6K)
Synonyms:70 kDa ribosomal protein S6 kinase 1 | 70 kDa ribosomal protein S6 kinase 1 (P70s6k) | 70 kDa ribosomal protein kinase (p70S6K) | Protein kinase 70S6K (T412E) | Ribosomal protein S6 kinase I | S6K1 | p70 S6 ribosomal protein kinase 1 | p70S6K1
Type:Enzyme
Mol. Mass.:59139.89
Organism:Homo sapiens (Human)
Description:His-tagged S6K1.
Residue:525
Sequence:
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50310456
n/a
NameBDBM50310456
Synonyms:4-(1-cyclobutyl-1H-benzo[d]imidazol-2-yl)-1,2,5-oxadiazol-3-amine | CHEMBL1079294
TypeSmall organic molecule
Emp. Form.C13H13N5O
Mol. Mass.255.2752
SMILESNc1nonc1-c1nc2ccccc2n1C1CCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: