Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCAM-RNase A
LigandBDBM50233301
Substrate/Competitorn/a
Meas. Tech.ChEMBL_620094
pH6±n/a
Ki 20100±n/a nM
Commentsextracted
Citation Dossi KTsirkone VGHayes JMMatousek JPoucková PSoucek JZadinova MZographos SELeonidas DD Mapping the ribonucleolytic active site of bovine seminal ribonuclease. The binding of pyrimidinyl phosphonucleotide inhibitors. Eur J Med Chem 44:4496-508 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CAM-RNase A
Name:CAM-RNase A
Synonyms:RNAse A
Type:Enzyme
Mol. Mass.:16468.79
Organism:Bison bison (American bison)
Description:carboxamidomethylated RNase A
Residue:150
Sequence:
MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRN
LTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPN
CAYKTTQANKHIIVACEGNPYVPVHFDASV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50233301
n/a
NameBDBM50233301
Synonyms:CHEMBL258728 | cytidine-3'-monophosphate
TypeSmall organic molecule
Emp. Form.C9H14N3O8P
Mol. Mass.323.1965
SMILESNc1ccn([C@@H]2O[C@H](CO)[C@@H](OP(O)(O)=O)[C@H]2O)c(=O)n1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: