| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, liver |
|---|
| Ligand | BDBM50310988 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_619185 (CHEMBL1102423) |
|---|
| Ki | 8170±n/a nM |
|---|
| Citation |  Hertzel, AV; Hellberg, K; Reynolds, JM; Kruse, AC; Juhlmann, BE; Smith, AJ; Sanders, MA; Ohlendorf, DH; Suttles, J; Bernlohr, DA Identification and characterization of a small molecule inhibitor of Fatty Acid binding proteins. J Med Chem52:6024-31 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, liver |
|---|
| Name: | Fatty acid-binding protein, liver |
|---|
| Synonyms: | FABP1 | FABPL | FABPL_HUMAN | Fatty acid-binding protein, liver | Liver fatty acid binding protein (human L-FABP T94T) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14208.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | human L-FABP |
|---|
| Residue: | 127 |
|---|
| Sequence: | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
KRISKRI
|
|
|
|---|
| BDBM50310988 |
|---|
| n/a |
|---|
| Name | BDBM50310988 |
|---|
| Synonyms: | 4-{[2-(methoxycarbonyl)-5-(2-thienyl)-3-thienyl]amino}-4-oxo-2-butenoic acid | 4-{[2-methoxycarbonyl)-5-(2-thienyl)-3-thienyl]amino}-4-oxo-2-butenoic acid | CHEMBL1077990 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H11NO5S2 |
|---|
| Mol. Mass. | 337.371 |
|---|
| SMILES | COC(=O)c1sc(cc1NC(=O)\C=C\C(O)=O)-c1cccs1 |
|---|
| Structure | 
|
|---|
Search and Browse
