Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEphrin type-B receptor 3 (EPHB3)
LigandBDBM50311311
Substrate/Competitorn/a
Meas. Tech.ChEMBL_620507
IC50 460±n/a nM
Citation Qiao LChoi SCase AGainer TGSeyb KGlicksman MALo DCStein RLCuny GD Structure-activity relationship study of EphB3 receptor tyrosine kinase inhibitors. Bioorg Med Chem Lett 19:6122-6 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ephrin type-B receptor 3 (EPHB3)
Name:Ephrin type-B receptor 3 (EPHB3)
Synonyms:Ephrin receptor | Ephrin type-B receptor 3
Type:Protein
Mol. Mass.:110326.17
Organism:Homo sapiens (Human)
Description:P54753
Residue:998
Sequence:
MARARPPPPPSPPPGLLPLLPPLLLLPLLLLPAGCRALEETLMDTKWVTSELAWTSHPES
GWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIP
NIPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRS
FGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGT
CIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGP
CLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWS
EPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTR
YTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPN
GVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEF
ETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQY
IAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREV
FVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALD
SFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLS
RFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYW
DMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAA
SLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQM
TAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50311311
n/a
NameBDBM50311311
Synonyms:CHEMBL1078738 | N-(2-chlorophenyl)imidazo[1,2-a]pyridine-3-carboxamide
TypeSmall organic molecule
Emp. Form.C14H10ClN3O
Mol. Mass.271.702
SMILESClc1ccccc1NC(=O)c1cnc2ccccn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: