| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nociceptin receptor |
|---|
| Ligand | BDBM50311512 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_622957 |
|---|
| Ki | 0.200000±n/a nM |
|---|
| Citation |  Palin R; Clark JK; Evans L; Feilden H; Fletcher D; Hamilton NM; Houghton AK; Jones PS; McArthur D; Montgomery B; Ratcliffe PD; Smith AR; Sutherland A; Weston MA; Wishart G Rapid access towards follow-up NOP receptor agonists using a knowledge based approach. Bioorg Med Chem Lett 19:6441-6 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nociceptin receptor |
|---|
| Name: | Nociceptin receptor |
|---|
| Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OPIATE ORL-1 | OPRL1 protein | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40702.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41146 |
|---|
| Residue: | 370 |
|---|
| Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
|---|
| BDBM50311512 |
|---|
| n/a |
|---|
| Name | BDBM50311512 |
|---|
| Synonyms: | 2-(3-(1-cyclodecylpiperidin-4-yl)-2-oxo-2,3-dihydro-1H-benzo[d]imidazol-1-yl)-N-methylacetamide | CHEMBL1088036 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H38N4O2 |
|---|
| Mol. Mass. | 426.5948 |
|---|
| SMILES | CNC(=O)Cn1c2ccccc2n(C2CCN(CC2)C2CCCCCCCCC2)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
