Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor delta
LigandBDBM50311792
Substrate/Competitorn/a
Meas. Tech.ChEMBL_619896
IC50 10±n/a nM
Citation Kasuga JIshida SYamasaki DMakishima MDoi THashimoto YMiyachi H Novel biphenylcarboxylic acid peroxisome proliferator-activated receptor (PPAR) delta selective antagonists. Bioorg Med Chem Lett 19:6595-9 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor delta
Name:Peroxisome proliferator-activated receptor
Synonyms:NR1C2 | NUC1 | NUCI | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR delta | PPAR-beta | PPARB | PPARD | Peroxisome proliferator-activated receptor beta
Type:Enzyme
Mol. Mass.:49910.45
Organism:Homo sapiens (Human)
Description:Q03181
Residue:441
Sequence:
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50311792
n/a
NameBDBM50311792
Synonyms:4'-butoxy-3'-((2-fluoro-4-(trifluoromethyl)benzamido)methyl)-2-methylbiphenyl-4-carboxylic acid | CHEMBL1082079
TypeSmall organic molecule
Emp. Form.C27H25F4NO4
Mol. Mass.503.4853
SMILESCCCCOc1ccc(cc1CNC(=O)c1ccc(cc1F)C(F)(F)F)-c1ccc(cc1C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: