Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase HCK
LigandBDBM50311908
Substrate/Competitorn/a
Meas. Tech.ChEMBL_619934
IC50 1875±n/a nM
Citation Zhang GRen PGray NSSim TWang XLiu YChe JDong WTian SSSandberg MLSpalding TARomeo RIskandar MWang ZSeidel HMKaranewsky DSHe Y Discovery of pyrimidine benzimidazoles as Src-family selective Lck inhibitors. Part II. Bioorg Med Chem Lett 19:6691-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase HCK
Name:Tyrosine-protein kinase HCK
Synonyms:HCK | Hematopoietic cell kinase | Hemopoietic cell kinase | p59-HCK/p60-HCK | p59Hck | p61Hck
Type:Enzyme Catalytic Domain
Mol. Mass.:59600.18
Organism:Homo sapiens (Human)
Description:P08631
Residue:526
Sequence:
MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
PGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50311908
n/a
NameBDBM50311908
Synonyms:4-methyl-3-(1-(6-(3-(4-methylpiperazin-1-yl)propylamino)pyrimidin-4-yl)-1H-benzo[d]imidazol-2-ylamino)-N-m-tolylbenzamide | CHEMBL1076197
TypeSmall organic molecule
Emp. Form.C34H39N9O
Mol. Mass.589.7332
SMILESCN1CCN(CCCNc2cc(ncn2)-n2c(Nc3cc(ccc3C)C(=O)Nc3cccc(C)c3)nc3ccccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: