Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSRC
LigandBDBM50311953
Substrate/Competitorn/a
Meas. Tech.ChEMBL_619954
IC50 140±n/a nM
Citation Shim JEid CLee JLiu EChaudhary DBoschelli DH Synthesis and PKCtheta inhibitory activity of a series of 5-vinyl phenyl sulfonamide-3-pyridinecarbonitriles. Bioorg Med Chem Lett 19:6575-7 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SRC
Name:SRC
Synonyms:5-HT6 | FYN | HTR6 | Tyrosine Kinase FYN | Tyrosine-protein kinase Fyn | Tyrosine-protein kinase Fyn (Fyn)
Type:Enzyme
Mol. Mass.:60762.21
Organism:Homo sapiens (Human)
Description:P06241
Residue:537
Sequence:
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50311953
n/a
NameBDBM50311953
Synonyms:4-(4-methyl-1H-indol-5-ylamino)-5-(3-(4-methylpiperazin-1-ylsulfonyl)styryl)nicotinonitrile | CHEMBL1080994
TypeSmall organic molecule
Emp. Form.C28H28N6O2S
Mol. Mass.512.626
SMILESCN1CCN(CC1)S(=O)(=O)c1cccc(\C=C\c2cncc(C#N)c2Nc2ccc3[nH]ccc3c2C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: