Reaction Details |
| Report a problem with these data |
Target | Low molecular weight protein-tyrosine phosphatase A |
---|
Ligand | BDBM50312253 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_621991 (CHEMBL1106782) |
---|
Ki | 22700±n/a nM |
---|
Citation | Rawls, KA; Lang, PT; Takeuchi, J; Imamura, S; Baguley, TD; Grundner, C; Alber, T; Ellman, JA Fragment-based discovery of selective inhibitors of the Mycobacterium tuberculosis protein tyrosine phosphatase PtpA. Bioorg Med Chem Lett19:6851-4 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Low molecular weight protein-tyrosine phosphatase A |
---|
Name: | Low molecular weight protein-tyrosine phosphatase A |
Synonyms: | PTPA_MYCTU | PTPase | Probable low molecular weight protein-tyrosine-phosphatase | Protein Tyrosine Phosphatase PTPA | mptpA | ptpA |
Type: | Hydrolase |
Mol. Mass.: | 17891.84 |
Organism: | Mycobacterium tuberculosis |
Description: | n/a |
Residue: | 163 |
Sequence: | MSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAG
VLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTH
ALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
|
|
|
BDBM50312253 |
---|
n/a |
---|
Name | BDBM50312253 |
Synonyms: | CHEMBL1075857 | difluoro(4-(4-fluorophenylcarbamoyl)phenyl)methylphosphonic acid |
Type | Small organic molecule |
Emp. Form. | C14H11F3NO4P |
Mol. Mass. | 345.2104 |
SMILES | OP(O)(=O)C(F)(F)c1ccc(cc1)C(=O)Nc1ccc(F)cc1 |
Structure |
|