| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight protein-tyrosine phosphatase A |
|---|
| Ligand | BDBM50312254 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_621991 (CHEMBL1106782) |
|---|
| Ki | 18500±n/a nM |
|---|
| Citation |  Rawls, KA; Lang, PT; Takeuchi, J; Imamura, S; Baguley, TD; Grundner, C; Alber, T; Ellman, JA Fragment-based discovery of selective inhibitors of the Mycobacterium tuberculosis protein tyrosine phosphatase PtpA. Bioorg Med Chem Lett19:6851-4 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Low molecular weight protein-tyrosine phosphatase A |
|---|
| Name: | Low molecular weight protein-tyrosine phosphatase A |
|---|
| Synonyms: | PTPA_MYCTU | PTPase | Probable low molecular weight protein-tyrosine-phosphatase | Protein Tyrosine Phosphatase PTPA | mptpA | ptpA |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 17891.84 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | n/a |
|---|
| Residue: | 163 |
|---|
| Sequence: | MSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAG
VLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTH
ALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
|
|
|
|---|
| BDBM50312254 |
|---|
| n/a |
|---|
| Name | BDBM50312254 |
|---|
| Synonyms: | CHEMBL1080494 | difluoro(4-(4-(trifluoromethyl)phenylcarbamoyl)phenyl)methylphosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H11F5NO4P |
|---|
| Mol. Mass. | 395.2179 |
|---|
| SMILES | OP(O)(=O)C(F)(F)c1ccc(cc1)C(=O)Nc1ccc(cc1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
