Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 3
LigandBDBM50312629
Substrate/Competitorn/a
Meas. Tech.ChEMBL_616014
IC50 3.3±n/a nM
Citation He RChen YChen YOugolkov AVZhang JSSavoy DNBilladeau DDKozikowski AP Synthesis and biological evaluation of triazol-4-ylphenyl-bearing histone deacetylase inhibitors as anticancer agents. J Med Chem 53:1347-56 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 3
Name:Histone deacetylase 3
Synonyms:HD3 | Histone deacetylase 3 (HDAC3) | Human HDAC3 | RPD3-2 | SMAP45
Type:Enzyme
Mol. Mass.:48829.55
Organism:Homo sapiens (Human)
Description:O15379
Residue:428
Sequence:
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50312629
n/a
NameBDBM50312629
Synonyms:CHEMBL1088736 | Octanedioic Acid-{3-[1-(3,5-Bis(hydroxymethyl)phenyl)-1H-[1,2,3]-triazol-4-yl]phenyl}amide-Hydroxyamide
TypeSmall organic molecule
Emp. Form.C24H29N5O5
Mol. Mass.467.5176
SMILESOCc1cc(CO)cc(c1)-n1cc(nn1)-c1cccc(NC(=O)CCCCCCC(=O)NO)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: