Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSialidase 2
LigandBDBM23411
Substrate/Competitorn/a
Meas. Tech.ChEMBL_617801
IC50 55000±n/a nM
Citation Arioka SSakagami MUematsu RYamaguchi HTogame HTakemoto HHinou HNishimura S Potent inhibitor scaffold against Trypanosoma cruzi trans-sialidase. Bioorg Med Chem 18:1633-40 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sialidase 2
Name:Sialidase 2
Synonyms:Cytosolic sialidase | N-acetyl-alpha-neuraminidase 2 | Sialidase-2
Type:PROTEIN
Mol. Mass.:42256.20
Organism:Homo sapiens (Human)
Description:ChEMBL_960638
Residue:380
Sequence:
MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYD
APTHQVQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRAN
VTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLHDRARSLVVPAYA
YRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHL
RARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTH
SWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYE
EIVFLMFTLKQAFPAEYLPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23411
n/a
NameBDBM23411
Synonyms:5,6,7-trihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | Scutellarein | Scutellarein (2) | Scutellarein (28)
Typeflavone
Emp. Form.C15H10O6
Mol. Mass.286.2363
SMILESOc1ccc(cc1)-c1cc(=O)c2c(O)c(O)c(O)cc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: