| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein tyrosine phosphatase type IVA 1 |
|---|
| Ligand | BDBM50312665 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_614707 (CHEMBL1113392) |
|---|
| IC50 | 676±n/a nM |
|---|
| Citation |  Chou, LC; Chen, CT; Lee, JC; Way, TD; Huang, CH; Huang, SM; Teng, CM; Yamori, T; Wu, TS; Sun, CM; Chien, DS; Qian, K; Morris-Natschke, SL; Lee, KH; Huang, LJ; Kuo, SC Synthesis and preclinical evaluations of 2-(2-fluorophenyl)-6,7-methylenedioxyquinolin-4-one monosodium phosphate (CHM-1-P-Na) as a potent antitumor agent. J Med Chem53:1616-26 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein tyrosine phosphatase type IVA 1 |
|---|
| Name: | Protein tyrosine phosphatase type IVA 1 |
|---|
| Synonyms: | PRL1 | PTP4A1 | PTPCAAX1 | TP4A1_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 19823.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1461024 |
|---|
| Residue: | 173 |
|---|
| Sequence: | MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEK
EGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALI
EGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
|
|
|
|---|
| BDBM50312665 |
|---|
| n/a |
|---|
| Name | BDBM50312665 |
|---|
| Synonyms: | CHEMBL1088572 | Sodium 2-(2-Fluorophenyl)-6,7-methylenedioxyquinolin-4-yl hydrogen phosphate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H12FNO6P |
|---|
| Mol. Mass. | 364.2423 |
|---|
| SMILES | OP([O-])(=O)OC1CC(=Nc2cc3OCOc3cc12)c1ccccc1F |c:7| |
|---|
| Structure | 
|
|---|
Search and Browse
