Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50312837
Substrate/Competitorn/a
Meas. Tech.ChEMBL_615859
Ki 9.6±n/a nM
Citation Fujinaga MKumata KYanamoto KKawamura KYamasaki TYui JHatori AOgawa MYoshida YNengaki NMaeda JZhang MR Radiosynthesis of novel carbon-11-labeled triaryl ligands for cannabinoid-type 2 receptor. Bioorg Med Chem Lett 20:1565-8 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50312837
n/a
NameBDBM50312837
Synonyms:CHEMBL1081610 | [11C]8-butoxy-N-cyclohexyl-7-methoxy-2-oxo-1,2-dihydroquinoline-3-carboxamide
TypeSmall organic molecule
Emp. Form.C21H28N2O4
Mol. Mass.372.458
SMILESCCCCOc1c(OC)ccc2cc(C(=O)NC3CCCCC3)c(=O)[nH]c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: