Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50312841
Substrate/Competitorn/a
Meas. Tech.ChEMBL_615860
Ki 2.3±n/a nM
Citation Fujinaga MKumata KYanamoto KKawamura KYamasaki TYui JHatori AOgawa MYoshida YNengaki NMaeda JZhang MR Radiosynthesis of novel carbon-11-labeled triaryl ligands for cannabinoid-type 2 receptor. Bioorg Med Chem Lett 20:1565-8 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CNR2 | Cannabinoid CB2 receptor | Cannabinoid receptor | rCB2
Type:Enzyme
Mol. Mass.:39366.68
Organism:Rattus norvegicus (Rat)
Description:Q9QZN9
Residue:360
Sequence:
MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50312841
n/a
NameBDBM50312841
Synonyms:CHEMBL1081609 | US9139546, 30 | [11C](3',5'-dichloro-2-hydroxy-6-methoxybiphenyl-4-yl)(thiophen-2-yl)methanone
TypeSmall organic molecule
Emp. Form.C18H12Cl2O3S
Mol. Mass.379.257
SMILESCOc1cc(cc(O)c1-c1cc(Cl)cc(Cl)c1)C(=O)c1cccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: