| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50312855 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_615876 (CHEMBL1102710) |
|---|
| Ki | 154±n/a nM |
|---|
| Citation |  Ballet, S; Marczak, ED; Feytens, D; Salvadori, S; Sasaki, Y; Abell, AD; Lazarus, LH; Balboni, G; Tourwé, D Novel multiple opioid ligands based on 4-aminobenzazepinone (Aba), azepinoindole (Aia) and tetrahydroisoquinoline (Tic) scaffolds. Bioorg Med Chem Lett20:1610-3 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50312855 |
|---|
| n/a |
|---|
| Name | BDBM50312855 |
|---|
| Synonyms: | (2S,2'S)-N,N'-((4S,4'S)-2,2'-(2,2'-(ethane-1,2-diylbis(azanediyl))bis(2-oxoethane-2,1-diyl))bis(3-oxo-2,3,4,5-tetrahydro-1H-benzo[c]azepine-4,2-diyl))bis(2-amino-3-(4-hydroxy-2,6-dimethylphenyl)propanamide) | CHEMBL1076737 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C48H58N8O8 |
|---|
| Mol. Mass. | 875.0229 |
|---|
| SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N[C@H]1Cc2ccccc2CN(CC(=O)NCCNC(=O)CN2Cc3ccccc3C[C@H](NC(=O)[C@@H](N)Cc3c(C)cc(O)cc3C)C2=O)C1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
