| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 1 |
|---|
| Ligand | BDBM50313339 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_617125 (CHEMBL1101383) |
|---|
| EC50 | 2.9±n/a nM |
|---|
| Citation |  Crosignani, S; Bombrun, A; Covini, D; Maio, M; Marin, D; Quattropani, A; Swinnen, D; Simpson, D; Sauer, W; Françon, B; Martin, T; Cambet, Y; Nichols, A; Martinou, I; Burgat-Charvillon, F; Rivron, D; Donini, C; Schott, O; Eligert, V; Novo-Perez, L; Vitte, PA; Arrighi, JF Discovery of a novel series of potent S1P1 agonists. Bioorg Med Chem Lett20:1516-9 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 1 |
|---|
| Name: | Sphingosine 1-phosphate receptor 1 |
|---|
| Synonyms: | CHEDG1 | EDG1 | Endothelial differentiation G-protein coupled receptor 1 | S1P receptor | S1P1 | S1PR1 | S1PR1_HUMAN | Sphingosine 1-phosphate receptor 1 (S1PR1) | Sphingosine 1-phosphate receptor Edg-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 42836.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21453 |
|---|
| Residue: | 382 |
|---|
| Sequence: | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
|
|
|
|---|
| BDBM50313339 |
|---|
| n/a |
|---|
| Name | BDBM50313339 |
|---|
| Synonyms: | 6-(cyclohexyl(propyl)amino)-N-(2-methyl-4-sulfamoylphenyl)pyrimidine-4-carboxamide | CHEMBL1088178 | US9150519, 1-54 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H29N5O3S |
|---|
| Mol. Mass. | 431.552 |
|---|
| SMILES | CCCN(C1CCCCC1)c1cc(ncn1)C(=O)Nc1ccc(cc1C)S(N)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
