Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProto-oncogene tyrosine-protein kinase Src
LigandBDBM4552
Substrate/Competitorn/a
Meas. Tech.ChEMBL_614491
IC50 3.8±n/a nM
Citation Morphy R Selectively nonselective kinase inhibition: striking the right balance. J Med Chem 53:1413-37 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Proto-oncogene tyrosine-protein kinase Src
Name:Proto-oncogene tyrosine-protein kinase Src
Synonyms:Proto-oncogene c-Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | Tyrosine-protein kinase Src (SRC) | V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | c-Src | p60-Src | pp60c-src
Type:Protein
Mol. Mass.:59838.60
Organism:Homo sapiens (Human)
Description:P12931
Residue:536
Sequence:
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4552
n/a
NameBDBM4552
Synonyms:4-[(2,4-Dichloro-5-methoxyphenyl)amino]-6-methoxy-7-[3-(4-methyl-1-piperazinyl)propoxy]-3-quinolinecarbonitrile | 4-[(2,4-dichloro-5-methoxyphenyl)amino]-6-methoxy-7-[3-(4-methylpiperazin-1-yl)propoxy]quinoline-3-carbonitrile | BOSUTINIB | CHEMBL288441 | SKI-606
TypeSmall organic molecule
Emp. Form.C26H29Cl2N5O3
Mol. Mass.530.446
SMILESCOc1cc(Nc2c(cnc3cc(OCCCN4CCN(C)CC4)c(OC)cc23)C#N)c(Cl)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: