Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase 11
LigandBDBM50273541
Substrate/Competitorn/a
Meas. Tech.ChEMBL_614516
Kd 380±n/a nM
Citation Morphy R Selectively nonselective kinase inhibition: striking the right balance. J Med Chem 53:1413-37 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase 11
Name:Serine/threonine-protein kinase 11
Synonyms:LKB1
Type:PROTEIN
Mol. Mass.:48640.33
Organism:Homo sapiens (Human)
Description:ChEMBL_655439
Residue:433
Sequence:
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI
RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI
IYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA
SSKIRRLSACKQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50273541
n/a
NameBDBM50273541
Synonyms:CHEMBL516312 | N-(5-(4-cyanophenyl)-1H-pyrrolo[2,3-b]pyridin-3-yl)nicotinamide
TypeSmall organic molecule
Emp. Form.C20H13N5O
Mol. Mass.339.3501
SMILESO=C(Nc1c[nH]c2ncc(cc12)-c1ccc(cc1)C#N)c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: