Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADAM17
LigandBDBM50313846
Substrate/Competitorn/a
Meas. Tech.ChEMBL_615262
Ki 0.500000±n/a nM
Citation Yu WGuo ZOrth PMadison VChen LDai CFeltz RJGirijavallabhan VMKim SHKozlowski JALavey BJLi DLundell DNiu XPiwinski JJPopovici-Muller JRizvi RRosner KEShankar BBShih NYSiddiqui MASun JTong LUmland SWong MKYang DYZhou G Discovery and SAR of hydantoin TACE inhibitors. Bioorg Med Chem Lett 20:1877-80 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ADAM17
Name:ADAM17
Synonyms:Disintegrin and metalloproteinase domain-containing protein 17 | Disintegrin and metalloproteinase domain-containing protein 17 (ADAM-17) | Disintegrin and metalloproteinase domain-containing protein 17 (ADAM17) | TACE | TNF-alpha convertase | TNF-alpha converting enzyme (TACE) | TNF-alpha-converting enzyme (TACE) | Tumor Necrosis Factor Alpha Converting Enzyme | Tumor necrosis factor-α converting enzyme (TACE)
Type:Enzyme
Mol. Mass.:93007.89
Organism:Homo sapiens (Human)
Description:
Residue:824
Sequence:
MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDL
QTSTHVETLLTFSALKRHFKLYLTSSTERFSQNFKVVVVDGKNESEYTVKWQDFFTGHVV
GEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQS
PKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYRYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQIEQIRILKSPQEVKPGEKHYNM
AKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPFCEREQQLESCACNETDNSC
KVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHPSNVEMLSSMD
SASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKD
PFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50313846
n/a
NameBDBM50313846
Synonyms:(R)-5-(4-fluorophenyl)-5-((5-hydroxy-1-oxoisoindolin-2-yl)methyl)imidazolidine-2,4-dione | CHEMBL1090059
TypeSmall organic molecule
Emp. Form.C18H14FN3O4
Mol. Mass.355.3199
SMILESOc1ccc2C(=O)N(C[C@]3(NC(=O)NC3=O)c3ccc(F)cc3)Cc2c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: