Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50314120
Substrate/Competitorn/a
Meas. Tech.ChEMBL_627675
IC50 1.2±n/a nM
Citation Debenham JSMadsen-Duggan CBToupence RBWalsh TFWang JTong XKumar SLao JFong TMXiao JCHuang CRShen CPFeng YMarsh DJStribling DSShearman LPStrack AMGoulet MT Furo[2,3-b]pyridine-based cannabinoid-1 receptor inverse agonists: synthesis and biological evaluation. Part 1. Bioorg Med Chem Lett 20:1448-52 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:CANN6 | CANNABINOID CB1 | CB-R | CB1 | CNR | CNR1 | Cannabinoid CB1 receptor | Cannabinoid receptor | Cannabinoid receptor 1 (CB1) | Cannabinoid receptor 1 (brain)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52868.96
Organism:Homo sapiens (Human)
Description:P21554
Residue:472
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50314120
n/a
NameBDBM50314120
Synonyms:CHEMBL1090404 | N-(6-(2-chlorophenyl)-5-(4-chlorophenyl)-2-pivaloylfuro[2,3-b]pyridin-3-yl)-2-(methylamino)acetamide
TypeSmall organic molecule
Emp. Form.C27H25Cl2N3O3
Mol. Mass.510.412
SMILESCNCC(=O)Nc1c(oc2nc(-c3ccccc3Cl)c(cc12)-c1ccc(Cl)cc1)C(=O)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: